SMART: Pfam domain CAML

The domain within your query sequence starts at position 21 and ends at position 290; the E-value for the CAML domain shown below is 8.8e-143.

SASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGSEEENQTKSKPQDSDKLNSLSIPSVS
KRVVLGDSVDGGGADQLGGVAEVRGTQLGDKLDSFIKAPECSSKDGAELRQRTRGDLTAD
PAQRASHHGLEQYLSRFEEAMKLRKQLISEKPSQEDGSTAEEFDSFRIFRLVGCALLALG
VRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKGEKKVKTTVLTAALLLSGIPAEVINRSMD
TYSKMGEVFTDLCVYFFTFIFCHELLDYWG

CAML

PFAM accession number:	PF14963
Interpro abstract (IPR016719):	This group represents a calcium signal-modulating cyclophilin ligand (CAML). Immunophilins consist of a family of highly conserved proteins binding with immunosuppressive drugs such as FK506, rapamycin and cyclosporin A [ (PUBMED:18635947) ]. The immunosuppressant drug cyclosporin A blocks a calcium-dependent signal from the T-cell receptor (TCR) that normally leads to T-cell activation. When bound to cyclophilin, cyclosporin A binds and inactivates the key signalling intermediate calcineurin. CAML acts downstream of the TCR and upstream of calcineurin by causing an influx of calcium [ (PUBMED:7522304) ]. The HIV-1 Vpu protein is required for efficient viral release from human cells. CAML is a Vpu-interacting host factor that restricts HIV-1 release. CAML is probably the mechanistic link between the two viral regulators Vpu and HIV-2 Env [ (PUBMED:18500349) ].

PFAM accession number:

PF14963

Interpro abstract (IPR016719):

This group represents a calcium signal-modulating cyclophilin ligand (CAML). Immunophilins consist of a family of highly conserved proteins binding with immunosuppressive drugs such as FK506, rapamycin and cyclosporin A [ (PUBMED:18635947) ]. The immunosuppressant drug cyclosporin A blocks a calcium-dependent signal from the T-cell receptor (TCR) that normally leads to T-cell activation. When bound to cyclophilin, cyclosporin A binds and inactivates the key signalling intermediate calcineurin. CAML acts downstream of the TCR and upstream of calcineurin by causing an influx of calcium [ (PUBMED:7522304) ].

The HIV-1 Vpu protein is required for efficient viral release from human cells. CAML is a Vpu-interacting host factor that restricts HIV-1 release. CAML is probably the mechanistic link between the two viral regulators Vpu and HIV-2 Env [ (PUBMED:18500349) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CAML