The domain within your query sequence starts at position 31 and ends at position 63; the E-value for the CAMSAP_CH domain shown below is 8.1e-7.

NAQLKKRPSVKPVQDLRQDLRDGVILAYLIEIV

CAMSAP_CH

• PFAM accession number: PF11971
• Interpro abstract (IPR022613):

  This domain is the N-terminal CH domain from calmodulin-regulated spectrin-associated proteins - CAMSAP proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CAMSAP_CH