The domain within your query sequence starts at position 853 and ends at position 988; the E-value for the CAP-ZIP_m domain shown below is 2.8e-55.
PFKSREPSSRIGKIQANLAINPAALLPTVALQIPGTKPVSSELAFPSSEPGRSHILESVP TLPGSVEAGVSFDLPAQADTLHSANKSRVKVRGKRRPQTRAARRLAAQESSEAEDVTVDR GPVAQLSSSPVLPNGH
CAP-ZIP_m |
---|
PFAM accession number: | PF15255 |
---|---|
Interpro abstract (IPR029341): | This domain is found on WASH complex subunits FAM21 [ (PUBMED:19922874) ] and CAP-ZIP proteins [ (PUBMED:15850461) ]. Proteins containing this domain are eukaryotic proteins that are typically between 305 and 1321 amino acids in length. The exact function of this domain is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CAP-ZIP_m