The domain within your query sequence starts at position 99 and ends at position 189; the E-value for the CARD_2 domain shown below is 6.2e-28.

KLEEHRLLLRRLEPEFKATVDPNDILSELSECLINQECEEIRQIRDTKGRMAGAEKMAEC
LIRSDKENWPKVLQLALEKDNSKFSELWIVD

CARD_2

CARD_2
PFAM accession number:PF16739
Interpro abstract (IPR031964):

This entry represents the CARD domain found in the DDX58 protein (also known as RIG1), which is a key protein in the cellular chordates' sentinel system to detect viral infection. This domain is near the N terminus of RIG1 and interacts with its C-terminal domain [(PUBMED:23063562)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CARD_2