SMART: Pfam domain CARM1

The domain within your query sequence starts at position 27 and ends at position 140; the E-value for the CARM1 domain shown below is 2.8e-73.

CATVSVFPGARLLTIGDANGEIQRHAEQQALRLEVRAGPDAAGIALYSHEDVCVFKCSVS
RETECSRVGRQSFIITLGCNSVLIQFATPHDFCSFYNILKTCRGHTLERSVFSE

CARM1

PFAM accession number:	PF11531
Interpro abstract (IPR020989):	Histone-arginine methyltransferase CARM1 (also known as coactivator-associated arginine methyltransferase 1) methylates arginine residues in several proteins involved in DNA packaging, transcription regulation, and mRNA stability [ (PUBMED:16146736) ]. CARM1 is recruited by several transcription factors and plays a critical role in gene expression as a positive regulator. This entry represents the N-terminal domain of CARM1. Structurally this domain adopts a PH domain-like fold, a common structural scaffold found in a broad range proteins with diverse activities, which is frequently found to regulate protein-protein interactions [ (PUBMED:17882262) ].

PFAM accession number:

PF11531

Interpro abstract (IPR020989):

Histone-arginine methyltransferase CARM1 (also known as coactivator-associated arginine methyltransferase 1) methylates arginine residues in several proteins involved in DNA packaging, transcription regulation, and mRNA stability [ (PUBMED:16146736) ]. CARM1 is recruited by several transcription factors and plays a critical role in gene expression as a positive regulator. This entry represents the N-terminal domain of CARM1. Structurally this domain adopts a PH domain-like fold, a common structural scaffold found in a broad range proteins with diverse activities, which is frequently found to regulate protein-protein interactions [ (PUBMED:17882262) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CARM1