The domain within your query sequence starts at position 778 and ends at position 1065; the E-value for the CARMIL_C domain shown below is 5.3e-76.

TQELCPVAMRVAEGHNKMLSNVAERVTVPRNFIRGALLEQAGQDIQNKLDEVKLSVVTYL
TNSIVDEILQELYHSHKSLARHLTQLRTLSDPPGGASQGQDPSSRGRGRNHDHEETDDEL
GTNIDTMAIKKQKRCRKIRPVSAFISGSPQDMESQLGSLGIPPGWFSGLGASQTTASGSW
EGLSELPTHGYKLRHQTQGRPRPPRTTPPGPGRPSVPVPGPRQENGMATRLDEGLEDFFS
RRVMDESSSYPRTLRTMRPGLSEPPLPPLQKKRRRGLFHFRRPRSFKG

CARMIL_C

CARMIL_C
PFAM accession number:PF16000
Interpro abstract (IPR031943):

This domain is found near to the C terminus of leucine-rich repeat-containing proteins in the CARMIL family, whose members are potential regulators of actin capping proteins. In leucine-rich repeat-containing protein 16A (LRRC16A) it includes the region responsible for interaction with F-actin-capping protein subunit alpha-2 (CAPZA2) [(PUBMED:16054028)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CARMIL_C