The domain within your query sequence starts at position 204 and ends at position 430; the E-value for the CASP_C domain shown below is 8.6e-72.

LRISNSDLSGRCAELQIHLTEATAKAVEQKELIARLEQDLSTIQSIQRPDAEGASEQGLE
KIPEPIKEATALFYGPSMSSSGTLPEGQVDSLLSIISSQRERFRTRNQELEAESRMAQHT
IQALQSELDSLRADNIKLFEKIKFLQSYPGRGIGSDDTELRYSSQYEERLDPFSSFSKRE
RQRKYLGLSPWDKATLGMGRLILSNKMARTISFFYTLFLHCLVFLVL

CASP_C

CASP_C
PFAM accession number:PF08172
Interpro abstract (IPR012955):

This domain is the C-terminal region of the CASP family of proteins. These are Golgi membrane proteins which are thought to have a role in vesicle transport [(PUBMED:12429822)].

GO process:intra-Golgi vesicle-mediated transport (GO:0006891)
GO component:integral component of Golgi membrane (GO:0030173)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CASP_C