The domain within your query sequence starts at position 422 and ends at position 527; the E-value for the CASP_C domain shown below is 1.8e-17.
AELQIHLTEATAKAVEQKELIARLEQDLSTIQSIQRPDAEGASEQGLEKIPEPIKEATAL FYGPSMSSSGTLPEGQVDSLLSIISSQRERFRTRNQELEAVREPHG
CASP_C |
 |
|---|
| PFAM accession number: | PF08172 |
|---|---|
| Interpro abstract (IPR012955): | This domain is the C-terminal region of the CASP family of proteins. These are Golgi membrane proteins which are thought to have a role in vesicle transport [ (PUBMED:12429822) ]. |
| GO process: | intra-Golgi vesicle-mediated transport (GO:0006891) |
| GO component: | integral component of Golgi membrane (GO:0030173) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CASP_C