The domain within your query sequence starts at position 471 and ends at position 906; the E-value for the CAS_CSE1 domain shown below is 1.3e-201.

ERLFTMRGSNNTTLFTAAEIAPFVEILLTNLFKALTLPGSSENEYIMKAIMRSFSLLQEA
IIPYIPTLITQLTQKLLAVSKNPSKPHFNHYMFEAICLSIRITCKANPAAVVNFEEALFL
VFTEILQNDVQEFIPYVFQVMSLLLETHKNDIPSSYMALFPHLLQPVLWERTGNIPALVR
LLQAFLERGSSTIATAAADKIPGLLGVFQKLIASKANDHQGFYLLNSIIEHMPPESVDQY
RKQIFILLFQRLQNSKTTKFIKSFLVFINLYCIKYGALALQEIFDGIQPKMFGMVLEKII
IPEIQKVSGNVEKKICAVGITKLLTECPPMMDTEYTKLWTPLLQSLIGLFELPEDDSIPD
EEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSM
VSTSLNAEALQYLQGY

CAS_CSE1

CAS_CSE1
PFAM accession number:PF03378
Interpro abstract (IPR005043): Mammalian cellular apoptosis susceptibility (CAS) proteins and the yeast chromosome-segregation protein, CSE1 are homologous [(PUBMED:7479798)]. CAS is involved in both cellular apoptosis and proliferation [(PUBMED:8639641), (PUBMED:8610099)]. Apoptosis is inhibited in CAS-depleted cells, while the expression of CAS correlates to the degree of cellular proliferation. Like CSE1, it is essential for the mitotic checkpoint in the cell cycle (CAS depletion blocks the cell in the G2 phase), and has been shown to be associated with the microtubule network and the mitotic spindle [(PUBMED:8610099)], as is the protein MEK, which is thought to regulate the intracellular localization (predominantly nuclear vs. predominantly cytosolic) of CAS. In the nucleus, CAS acts as a nuclear transport factor in the importin pathway [(PUBMED:9323134)]. The importin pathway mediates the nuclear transport of several proteins that are necessary for mitosis and further progression. CAS is therefore thought to affect the cell cycle through its effect on the nuclear transport of these proteins [(PUBMED:9323134)]. Since apoptosis also requires the nuclear import of several proteins (such as P53 and transcription factors), it has been suggested that CAS also enables apoptosis by facilitating the nuclear import of at least a subset of these essential proteins [(PUBMED:9497270)]. This entry represents the C-terminal portion of these proteins. Structural studies of the yeast CSE1 protein indicate that this domain binds to both the transport-orchestrating protein RanGTP and the cargo molecule that is being exported [(PUBMED:15602554)].
GO function:protein binding (GO:0005515)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CAS_CSE1