The domain within your query sequence starts at position 569 and ends at position 1088; the E-value for the CATSPERB domain shown below is 1.1e-258.

FKTIHLGKTIEFSKTGLANIKNVYMHKTEPVGFQTSIHTEIIVPFGIENSKDSPCLLSDL
EITYSGKLYYTIKLLSKNPLHELKSTDVEKSVLIPGYSSFLIMNITDKWTASALATMPQA
IKSNLKFLTGSWFLYNFGTAGGRKWSISTRQCNYWIQQDSLDFMSLNLVKYIDVGNTIDF
QFKIIPKAMSTFPIPPVSMVVGNPGLVEVKTQGVFDLNENYYLDIHVSGRFFQKGSTSIA
LVLWEGSSKCYAITLLPTIKSSCSYLRTMHHTPGRHIPPEDWISGVHKDSQGFNMIKTLP
INYRPPSHMGISIPLTDNFYHADPSKPIPRNQFHKSKETGKYKQCANVTSRAMCNCSEHQ
KFSHAVAFSDCKEKVHRFKFPVTQYPVVLEIFNERDKISAEPPYLVTMTEVNMRKNWQLK
HNEPENVKKMKHYLEPLLKTPVYNPLGLNLTIQGSELFHFKVSVVPGVSFCELSEEFQIY
VDEVPLPFPGHALIAVATSVVLGVLIFIAFVFQLRNIHPL

CATSPERB

CATSPERB
PFAM accession number:PF15149
Interpro abstract (IPR028748):

CATSPER (cationic channel of sperm) is a complex ion channel that mediates Ca2+ entry in sperm flagellum and is required for sperm hyperactivation and male fertility [(PUBMED:11595941)]. The CATSPER channel consists of four CatSper proteins (CatSper1-4) that form a tetramer surrounding a Ca(2+)-selective pore.

In addition to the pore-forming proteins, the CATSPER channel contains auxiliary subunits [(PUBMED:21224844)]. One of these auxiliary proteins is CatSper-beta [(PUBMED:17478420)]. It is probably required for trafficking or formation of a stable channel complex.

GO component:CatSper complex (GO:0036128)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CATSPERB