The domain within your query sequence starts at position 207 and ends at position 774; the E-value for the CATSPERD domain shown below is 1.7e-200.

WVIHLPMSTDDIAKVIQGNNVDFQDCRIADLHFLLTFPMEIVLEPPGYLPLTLPPGSPLM
LSWDTCISTFALLATDQETFQTNDSFQTWTRVRAPPGILSDAQRHSLRDVLVFRTGILFL
VETTVYLKTDNEFIKLDKSRGISETGILGLSKRRWCQIRYLYKSAAGRTFVLAWTKSEVY
GGFGKFKFMRFTTTSRLKYLLKLPPTDTLEIITVEYSWHPLEAAALLSHCSVCTTTKNIR
MVIFNSAYFSWKLQDFELQVPKEAKLEYRFLYSAMPDIIVWDEHQVYYGYRNFAVFGTIT
TASGETNLSSLSQGSNIHQVLTDSIGNVVVKMENNVMFYIKADITEAVILHTWVNTTAKT
GLFFDKSFEVCILYYNENLDEKYQLQTQPYPLILELQSINKDLGDWCPYLAFQHNIHSQF
YHMDKGESLTIWSQIVYPENRGLYIVLEHYGMRILTWTQNIEYEIASGFCTKTLITRFFQ
TTNYELVDNYYQLQKENTGLLVFQFRPSEFSRMCPTAKPVFEIDVGCDSSKHIMVQGFNR
SGCQRRDFSYVIDKELLRESLSDNLVRN

CATSPERD

CATSPERD
PFAM accession number:PF15020
Interpro abstract (IPR028751):

CATSPER (cationic channel of sperm) is a complex ion channel that mediates Ca2+ entry in sperm flagellum and is required for sperm hyperactivation and male fertility [(PUBMED:11595941)]. The CATSPER channel consists of four CatSper proteins (CatSper1-4) that form a tetramer surrounding a Ca(2+)-selective pore. In addition to the pore-forming proteins, the CATSPER channel contains auxiliary subunits, including CatSperD (cation channel sperm-associated protein subunit delta) [(PUBMED:21224844)] and CatSperE. CatSperD is essential for the cation channel function and may play a role in channel assembly or transport.

GO component:CatSper complex (GO:0036128)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CATSPERD