The domain within your query sequence starts at position 305 and ends at position 453; the E-value for the CBF domain shown below is 2.7e-43.
SLLALNGLFILIHKHNLEYPDFYQKLYGLLDPSIFHVKYRARFFHLADLFLSSSHLPAYL VAAFAKRLARLALTAPPEALLMVLPLICNLLRRHPACRVMVHRPQGPELDADPYDPTEKD PARSRALESCLWELQTLQQHYHPEVSKAA
CBF |
---|
PFAM accession number: | PF03914 |
---|---|
Interpro abstract (IPR005612): | This domain is present in the CAATT-binding protein which is essential for growth and necessary for 60S ribosomal subunit biogenesis. Other proteins containing this domain stimulate transcription from the HSP70 promoter. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CBF