The domain within your query sequence starts at position 1 and ends at position 54; the E-value for the CBFD_NFYB_HMF domain shown below is 6.7e-14.
MQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCI
CBFD_NFYB_HMF |
---|
PFAM accession number: | PF00808 |
---|---|
Interpro abstract (IPR003958): | This domain is found in archaebacterial histones and histone-like transcription factors from eukaryotes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CBFD_NFYB_HMF