The domain within your query sequence starts at position 127 and ends at position 191; the E-value for the CBFD_NFYB_HMF domain shown below is 6.8e-6.
SAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKVFVGEVVEEALDVCEKWGETPPLQPKH MREAV
CBFD_NFYB_HMF |
 |
|---|
| PFAM accession number: | PF00808 |
|---|---|
| Interpro abstract (IPR003958): | This domain is found in archaebacterial histones and histone-like transcription factors from eukaryotes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CBFD_NFYB_HMF