The domain within your query sequence starts at position 57 and ends at position 106; the E-value for the CBFD_NFYB_HMF domain shown below is 9.8e-22.

IYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCH

CBFD_NFYB_HMF

• PFAM accession number: PF00808
• Interpro abstract (IPR003958):

  This domain is found in archaebacterial histones and histone-like transcription factors from eukaryotes.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CBFD_NFYB_HMF