The domain within your query sequence starts at position 8 and ends at position 50; the E-value for the CBFD_NFYB_HMF domain shown below is 3.1e-10.

LNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATS

CBFD_NFYB_HMF

CBFD_NFYB_HMF
PFAM accession number:PF00808
Interpro abstract (IPR003958):

This domain is found in archaebacterial histones and histone-like transcription factors from eukaryotes.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CBFD_NFYB_HMF