The domain within your query sequence starts at position 1 and ends at position 79; the E-value for the CBFNT domain shown below is 1.3e-16.
MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAAAAQGPAAAAGSGSGGGGSAAGGTEGGS AEAEGAKIDASKNEEDEGH
CBFNT |
 |
|---|
| PFAM accession number: | PF08143 |
|---|---|
| Interpro abstract (IPR012956): | This N-terminal domain is found in CARG-binding factor A-like proteins [ (PUBMED:15112237) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CBFNT