The domain within your query sequence starts at position 1 and ends at position 79; the E-value for the CBFNT domain shown below is 2.2e-18.
MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAAAAQGPAAAAGSGSGGGGSAAGGTEGGS AEAEGAKIDASKNEEDEGS
CBFNT |
---|
PFAM accession number: | PF08143 |
---|---|
Interpro abstract (IPR012956): | This N-terminal domain is found in CARG-binding factor A-like proteins [ (PUBMED:15112237) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CBFNT