The domain within your query sequence starts at position 147 and ends at position 283; the E-value for the CBM_21 domain shown below is 5.6e-30.

VPGGSGVWVPGGRPPVVRGLVRVLNRSFEKAVHVRASHDGWATFCDHPARYVPRSPPGAG
VGGTGAGDPLLDPGLGLGPGQMSASSPDDGGCTDRFAFQLPFAEGASDGARLDFVVRYET
PEGTFWANNHGRNYTVL

CBM_21

CBM_21
PFAM accession number:PF03370
Interpro abstract (IPR005036):

The carbohydrate binding type-21 or CBM21 domain is a 90-130 amino acid carbohydrate binding domain. The domain is named after proteins classified in carbohydrate-binding module (CBM) family 21 and is sometimes called starch-binding domain (SBD) [(PUBMED:15939348)]. The CBM21 domain occurs in several eukaryotic proteins implicated in glycogen metabolism. A glucoamylase active site region or alpha amylase catalytic domain can occur C-terminal to the CBM21 domain. The CBM21 domain of Rhizopus oryzae glucoamylase can bind to raw starch. Most conserved residues are located in a region with a length of 35 in the N-terminal part [(PUBMED:9046081)] and in a 15-25 residue motif II at the C terminus of the domain [(PUBMED:9046081), (PUBMED:9045612), (PUBMED:16262690)].

GO function:protein binding (GO:0005515)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CBM_21