The domain within your query sequence starts at position 623 and ends at position 679; the E-value for the CBS domain shown below is 5.7e-9.

AGGCPTQPVTLQLSPETSLYQAHRLFELLTLQALFVTSRGRAVGSVSWVELKKAIST

CBS

CBS
PFAM accession number:PF00571
Interpro abstract (IPR000644):

CBS domains are small intracellular modules that pair together to form a stable globular domain [(PUBMED:10200156)]. Pairs of these domains have been termed a Bateman domain [(PUBMED:14722609)]. CBS domains have been shown to bind ligands with an adenosyl group such as AMP, ATP and S-AdoMet [(PUBMED:14722619)]. CBS domains are found attached to a wide range of other protein domains suggesting that CBS domains may play a regulatory role making proteins sensitive to adenosyl carrying ligands. The region containing the CBS domains in cystathionine-beta synthase is involved in regulation by S-AdoMet [(PUBMED:11524006)]. CBS domain pairs from AMPK bind AMP or ATP [(PUBMED:14722619)]. The CBS domains from IMPDH and the chloride channel CLC2 bind ATP [(PUBMED:14722619)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CBS