The domain within your query sequence starts at position 6 and ends at position 710; the E-value for the CCCAP domain shown below is < 1e-12.

GNSTLEDSLGQYQRSLRERANRSIHQLKCALREVDVTVEEDALDPSTSINVENEDTGVAW
HELQHSHAVNQLKALLRQQTNKENETSPPRRRKLSPSRPSECDDGSMPTMHNLVPIINDQ
SQYIHHLEAEVKFCKDELSGMKNRVQVVVLENERLQQELKSQRPEETLREQTFLDASGNM
QNSWIMTREDSRVDEAAKRPFSHGDAETGKTASTGDANKWKLELERLKLTYEAKTDLLES
QLMLLRKDLAEYQKTCEDLKERLKHKESLLAASASSRVGGLCLKCAQHEAVLSQTHSNVH
IQTIERLTKERDDLMSVLVSVRSSLAEAQKRETSAYEQVKHAVQMTEEANFEKTKALIQC
EQLKSELERQTERLEKELASQQEKRAVEKEMIKKEVAREREDAESKMLILSQNIAKLEAQ
VEKVTREKTAAVSHLEEIQNHVASQEMDVTKVCGEMRFQLNKTKMEKDEVEKEHREYKAK
SHKDLEMKVQEIEKLRLELSESEQHVEQEQQKAARARQECLRVTELLGEAERQLHLTRLE
KDSIQQSFSNEAKAQALQAQQREQELTQKIQQMETQHDKTESEQYLLLTSQNTFLTKLKE
ECCLLAKKLEKVSLKSRSQIVRLSQEKRYLCDKLEKLQKRNDELEEQCIQHGRVHETMKE
RLRQLDKHGQATAQQLVQLLNKQNQLLLERQNLSEEVARLRAQLP

CCCAP

CCCAP
PFAM accession number:PF15964
Interpro abstract (IPR031887):

Serologically defined colon cancer antigen 8 (SDCCAG8), also known as CCCAP (centrosomal colon cancer autoantigen protein), is a family of proteins found in eukaryotes. Mutations of SDCCAG8 are associated with nephronophthisis [(PUBMED:20835237)] and Bardet-Biedl syndrome [(PUBMED:22626039)], as well as schizophrenia. SDCCAG8 is associated with the centrosome [(PUBMED:12559564)] and interacts with pericentriolar material 1 (PCM1), a centriolar satellite protein crucial for targeting proteins to the centrosome. It regulates centrosomal accumulation of pericentriolar material and neuronal polarisation and migration in the developing mouse cortex [(PUBMED:25088364)].

SDCCAG8 is localized at both centrioles and interacts directly with OFD1 (oral-facial-digital syndrome 1), which is linked to an autosomal recessive cystic kidney disease, NPHP-RC (nephronophthisis-related ciliopathies). Depletion of SDCCAG8 causes kidney cysts and a body axis defect in zebrafish [(PUBMED:20835237)].

GO process:centrosome cycle (GO:0007098)
GO component:centrosome (GO:0005813)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CCCAP