The domain within your query sequence starts at position 286 and ends at position 714; the E-value for the CCDC142 domain shown below is 1.6e-159.

QALGSALGGQSSPASLSPTSELLQRLFPPLLDSLRQPRPELRLCPPAGPTPVALGLCTLQ
TTLLWFVGRAQQHLAAWDPGSFLLLLQKDLPPLLSAVEALSSLASEAALTLEVEQQLGLE
IHNLTEKMQLLPKESLGLFVQECHKQATQGFKLHMPRGRYWRLRLCPEPPSDPSEYARIV
VYSVLEPVLQGLQGLPPEAQAPALGQALTATLGAWLDHILTHGIRFSLQGALQLKQDFGV
VREVLEQEQWGLSQELRQTLLSLSIFQQLDGALLCLLQQPLPKNPVHRRPPRCCLCYEVQ
TTELPTSSLNSLENLAPPLRLGVSPAQNTHLLSTLGGGGRGGGGGGGPGPSPEAYLVGNQ
QAWLALRLHQHPRWHLPFFSCLRTSPEP

CCDC142

CCDC142
PFAM accession number:PF14923
Interpro abstract (IPR026700): This entry contains coiled-coil domain-containing proteins. Their function is not known.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CCDC142