The domain within your query sequence starts at position 886 and ends at position 1190; the E-value for the CCDC144C domain shown below is 2e-142.

NQRLQDEVAVLRLEMDTIKSHNQEKEKRYLEDIKIANEKNDNLQRMVKLNEETFTKTIFQ
YTGQLNSLKAENTMLSSKLDNEKQNKERLETDVESFRSRLASALHDHAEIQTAKRDLEIA
FQRARDEWFRVKDKMNFDMSNLRDNNEVLSQQLSKTERKLNSLEIEFHHTKDELREKTLA
LKHAQRDLSQTQCQMKEVEHMFQDEQGKVSKFMGKQESIEERLAQLQSENTLLRQQLDDA
ANKAESKDKTIVNIQDQFQDVLTRFQAESQRHSLRLEDRNQELVSECSHLRERLCQYENE
KAERE

CCDC144C

CCDC144C
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CCDC144C