The domain within your query sequence starts at position 21 and ends at position 201; the E-value for the CCDC24 domain shown below is 3.9e-67.
RPEVKRILGEAAVDLSLELREEVAMLKALLQEIQSSQVSNSDPPSLLAPPPLLRDLIRQE LRQLLQGLRLKAISEGRDQTQMWAQYSPRVLRFALEDTRCDSTQQELPMRADEPSTCPRD LTVIKDQLNVSNIDQVVRHLRSLLEEECHMLQNEISDLQHCLEMEQMQACQPSKDTQMPT L
CCDC24 |
![]() |
---|
PFAM accession number: | PF15669 |
---|---|
Interpro abstract (IPR031367): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 187 and 319 amino acids in length. There are two completely conserved residues (G and P) that may be functionally important. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CCDC24