The domain within your query sequence starts at position 4 and ends at position 128; the E-value for the CCDC50_N domain shown below is 1.5e-50.

VSVDQSKLPGVKEVCRDFAVLEDHTLAHSLQEQEIEHHLASNIQRNRLVQHDLQVAKQLQ
EEDLKAQAQLQKRYKALEQHDCEIAQEIQEKLTIEAERRRIQEKKDEDIARLLQEKELQE
EKRRK

CCDC50_N

CCDC50_N
PFAM accession number:PF15295
Interpro abstract (IPR029311):

This entry represents the N-terminal domain of the coiled-coil domain-containing protein 50 (CCDC50). Human CCDC50 is overexpressed in mantle cell lymphoma and chronic lymphocytic leukemia. Its involvement in NFkappaB signalling pathways may have major effects on cell survival [(PUBMED:19641524)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CCDC50_N