The domain within your query sequence starts at position 409 and ends at position 561; the E-value for the CCDC66 domain shown below is 1e-49.

NLGAQVDYKAFTTISSSHSDPEETADTSTASPKKDTGVQTDDVNLGIFNDALPPCGSVTE
KGIRNISSPEISAEFSGQTDIRKENQELSMNKGTNLDKENSWHNGQCNQYRRTEKQTKLM
KKCPKKPAWNINKPLKKYVPASAKYPAHLQKEK

CCDC66

CCDC66
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CCDC66