The domain within your query sequence starts at position 6 and ends at position 323; the E-value for the CCDC84 domain shown below is 2.5e-95.

RCPLCRQTFFCGRGHVYSHKHQRQLKGALERLLPQVEAARRAVRAAQVERYVPEHDRCCW
CPCCGCEVRKHLSHGNLTVLHGGLLEHLASPEHKKATNKFWWENKANAQMKEKFLISPQD
YARFKKSMVKGLDSYEEKEDEVIKEMAAQIREVEQSRQEVVRSVLEPQAESDPEEGSSAP
ESWKATNGHVASSSQQVSHLALQPVAELDWMETGQQLTFIGHQDTPGIGNIHSGATPPWM
IQEEEHSSGSLPIGPSYEEFLKEKEKQKLKKLPPDRVGANFDHSSNTSAGWLPSFGRVWN
NGRRWQSRHQFKTEAATR

CCDC84

CCDC84
PFAM accession number:PF14968
Interpro abstract (IPR028015):

The function of this coiled-coil domain-containing family is not known. It is found in eukaryotes. This entry also include TITAN-like protein (TTL; At4g24900) from Arabidopsis. TTL is a key regulator for endosperm and embryo nuclear divisions [(PUBMED:22991160)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CCDC84