The domain within your query sequence starts at position 43 and ends at position 99; the E-value for the CCDC92 domain shown below is 3.1e-22.
EHQIQSVQRHISFLKKEQMALLRDLHLEILRLQKRCSELTHDLEMREVQSHQQEEAS
CCDC92 |
---|
PFAM accession number: | PF14916 |
---|---|
Interpro abstract (IPR039496): | This entry represents the coiled-coil domain found in uncharacterized proteins CCDC92 and CCDC74. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CCDC92