The domain within your query sequence starts at position 43 and ends at position 99; the E-value for the CCDC92 domain shown below is 3.1e-22.

EHQIQSVQRHISFLKKEQMALLRDLHLEILRLQKRCSELTHDLEMREVQSHQQEEAS

CCDC92

 CCDC92
PFAM accession number:PF14916
Interpro abstract (IPR039496):

This entry represents the coiled-coil domain found in uncharacterized proteins CCDC92 and CCDC74.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CCDC92