The domain within your query sequence starts at position 50 and ends at position 105; the E-value for the CCDC92 domain shown below is 4.1e-24.

QKRILDLEKSLQFLQQQHSETLVKLHEEIEHLKRENKDLHYKLIMNEKPQKKGSIS

CCDC92

• PFAM accession number: PF14916
• Interpro abstract (IPR039496):

  This entry represents the coiled-coil domain found in uncharacterized proteins CCDC92 and CCDC74.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CCDC92