SMART: Pfam domain CCM2

The domain within your query sequence starts at position 296 and ends at position 396; the E-value for the CCM2_C domain shown below is 8.9e-50.

SESELSTSATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCISLRQLYGDSR
KFLLLGLRPFIPEKDSQHFENFLETIGVKDGRGIITDSFGR

CCM2_C

PFAM accession number:	PF16545
Interpro abstract (IPR032375):	This entry represents the C-terminal folded helical region of cerebral cavernous malformations protein 2 (CCM2, also known as malcavernin), a component of the CCM signalling pathway which is a crucial regulator of heart and vessel formation and integrity [ (PUBMED:14624391) ]. This domain is structurally homologous to the N-terminal domain of harmonin, so it is named the harmonin-homology domain (HHD). The structure of this domain has been revealed [ (PUBMED:23266514) ].

PFAM accession number:

PF16545

Interpro abstract (IPR032375):

This entry represents the C-terminal folded helical region of cerebral cavernous malformations protein 2 (CCM2, also known as malcavernin), a component of the CCM signalling pathway which is a crucial regulator of heart and vessel formation and integrity [ (PUBMED:14624391) ]. This domain is structurally homologous to the N-terminal domain of harmonin, so it is named the harmonin-homology domain (HHD). The structure of this domain has been revealed [ (PUBMED:23266514) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CCM2_C