The domain within your query sequence starts at position 49 and ends at position 121; the E-value for the CCSMST1 domain shown below is 6.1e-27.
NLPIQFSGSKATPIRWTVEHSLGKPQQRPWWKVLPLTLTLVALVVWCYQREESGMDLWLR QVLEEEDEEEPEG
CCSMST1 |
---|
PFAM accession number: | PF15013 |
---|---|
Interpro abstract (IPR029160): | This family of proteins was discovered in a screen of Bos taurus placental ESTs. The B. taurus member of this family was named cattle cerebrum and skeletal muscle-specific transcript 1 (CCSMST1) [ (PUBMED:16554549) ], hence the name of the family. This family of proteins is found in metazoa, both in vertebrates and invertebrates. Proteins are typically between 97 and 157 amino acids in length with a single completely conserved residue D that may be functionally important. Their function is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CCSMST1