The domain within your query sequence starts at position 115 and ends at position 191; the E-value for the CD225 domain shown below is 2.4e-23.

EVYPDTTEVNDYYLWSIFNFVYLNFCCLGFIALAYSLKVRDKKLLNDLNGAVEDAKTARL
FNITSSALAASCIILIF

CD225

CD225
PFAM accession number:PF04505
Interpro abstract (IPR007593): This family includes the human leukocyte antigen CD225, which is an interferon inducible transmembrane protein, and is associated with interferon induced cell growth suppression [(PUBMED:7559564)].
GO process:response to biotic stimulus (GO:0009607)
GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CD225