The domain within your query sequence starts at position 26 and ends at position 75; the E-value for the CD24 domain shown below is 2.9e-26.

CNQTSVAPFPGNQNISASPNPSNATTRGGGSSLQSTAGLLALSLSLLHLY

CD24

 CD24
PFAM accession number:PF14984
Interpro abstract (IPR028029):

Signal transducer CD24 (also known as cluster of differentiation 24) is a cell adhesion molecule that has been implicated in tumor invasion and metastasis of various solid tumours [ (PUBMED:23318912) ].

GO process:cell adhesion (GO:0007155)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CD24