The domain within your query sequence starts at position 16 and ends at position 463; the E-value for the CD36 domain shown below is 6.4e-154.

ALGLLFAALGVVMILMVPSLIKQQVLKNVRIDPSSLSFGMWKEIPVPFYLSVYFFEVVNP
NEVLNGQKPVVRERGPYVYREFRQKVNITFNDNDTVSFVENRSLHFQPDKSHGSESDYIV
LPNILVLGGSILMESKPVSLKLMMTLALVTMGQRAFMNRTVGEILWGYDDPFVHFLNTYL
PDMLPIKGKFGLFVGMNNSNSGVFTVFTGVQNFSRIHLVDKWNGLSKIDYWHSEQCNMIN
GTSGQMWAPFMTPESSLEFFSPEACRSMKLTYNESRVFEGIPTYRFTAPDTLFANGSVYP
PNEGFCPCRESGIQNVSTCRFGAPLFLSHPHFYNADPVLSEAVLGLNPNPKEHSLFLDIH
PVTGIPMNCSVKMQLSLYIKSVKGIGQTGKIEPVVLPLLWFEQSGAMGGKPLSTFYTQLV
LMPQVLHYAQYVLLGLGGLLLLVPIICQ

CD36

CD36
PFAM accession number:PF01130
Interpro abstract (IPR002159):

This entry includes CD36 and CD36-like proteins, including SCARB1/2 from vertebrates and SNMP1/2 from flies.

CD36 is a transmembrane, highly glycosylated, 88kDa glycoprotein expressed by monocytes, macrophages, platelets, microvascular endothelial cells and adipose tissues. Platelet glycoprotein IV (GP IV)(GPIIIb) (CD36 antigen) is also called GPIV, OKM5-antigen or PASIV. CD36 recognises oxidized low density lipoprotein, long chain fatty acids, anionic phospholipids, collagen types I, IV and V, thrombospondin (TSP) and Plasmodium falciparum infected erythrocytes. The recognition of apoptotic neutrophils is in co-operation with TSP and avb3. Other ligands may still be unknown.

CD36 is a scavenger receptor for oxidized LDL and shed photoreceptor outer segments and in recognition and phagocytosis of apoptotic cells and is the cell adhesion molecule in platelet adhesion and aggregation, platelet-monocyte and platelet-tumor cell interaction [(PUBMED:9478926)].

GO component:membrane (GO:0016020)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CD36