The domain within your query sequence starts at position 121 and ends at position 180; the E-value for the CD45 domain shown below is 2.1e-22.
TVNYTYESSNQTFKADLKDVQNAKCGNEDCENVLNNLEECSQIKNISVSNDSCAPATTID
CD45 |
![]() |
---|
PFAM accession number: | PF12567 |
---|---|
Interpro abstract (IPR016335): | Receptor-type tyrosine-protein phosphatase C, also known as CD45, is a tyrosine-protein phosphatase required for T-cell activation through the antigen receptor [(PUBMED:2845400)]. It acts as a positive regulator of T-cell co-activation upon binding to DPP4 (CD26) [(PUBMED:11593028)]. |
GO process: | T cell receptor signaling pathway (GO:0050852) |
GO function: | protein tyrosine phosphatase activity (GO:0004725) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CD45