The domain within your query sequence starts at position 211 and ends at position 270; the E-value for the CD45 domain shown below is 2.1e-24.

TVNYTYESSNQTFKADLKDVQNAKCGNEDCENVLNNLEECSQIKNISVSNDSCAPATTID

CD45

CD45
PFAM accession number:PF12567
Interpro abstract (IPR016335):

Receptor-type tyrosine-protein phosphatase C, also known as CD45, is a tyrosine-protein phosphatase required for T-cell activation through the antigen receptor [(PUBMED:2845400)]. It acts as a positive regulator of T-cell co-activation upon binding to DPP4 (CD26) [(PUBMED:11593028)].

GO process:T cell receptor signaling pathway (GO:0050852)
GO function:protein tyrosine phosphatase activity (GO:0004725)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CD45