SMART: Pfam domain CD52

The domain within your query sequence starts at position 23 and ends at position 74; the E-value for the CD52 domain shown below is 1.4e-24.

LGQATTAASGTNKNSTSTKKTPLKSGASSIIDAGACSFLFFANTLMCLFYLS

CD52

PFAM accession number:	PF15116
Interpro abstract (IPR026643):	CAMPATH-1 antigen (also known as CD52) is a very small glycosylphosphatidylinositol (GPI)-anchored glycoprotein present in lymphocytes male reproductive tracts and female cumulus cells [ (PUBMED:1711975) (PUBMED:7688956) (PUBMED:8418821) (PUBMED:9464849) (PUBMED:18647288) ]. CD52 on the lymphocyte membrane surface induces regulatory T cells with immunosuppressive activities [ (PUBMED:16797237) ]. In the male reproductive tract, CD52 may protect sperm function from complement attack if antisperm antibody is generated in the female reproductive tracts [ (PUBMED:22386526) ]. It has also been suggested that CD52 has some functional roles around fertilisation in females as well as in males [ (PUBMED:18647288) ].

PFAM accession number:

PF15116

Interpro abstract (IPR026643):

CAMPATH-1 antigen (also known as CD52) is a very small glycosylphosphatidylinositol (GPI)-anchored glycoprotein present in lymphocytes male reproductive tracts and female cumulus cells [ (PUBMED:1711975) (PUBMED:7688956) (PUBMED:8418821) (PUBMED:9464849) (PUBMED:18647288) ]. CD52 on the lymphocyte membrane surface induces regulatory T cells with immunosuppressive activities [ (PUBMED:16797237) ]. In the male reproductive tract, CD52 may protect sperm function from complement attack if antisperm antibody is generated in the female reproductive tracts [ (PUBMED:22386526) ]. It has also been suggested that CD52 has some functional roles around fertilisation in females as well as in males [ (PUBMED:18647288) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CD52