The domain within your query sequence starts at position 73 and ends at position 520; the E-value for the CDC45 domain shown below is 4.5e-138.

IKQEDDLEVPAYDDIFRDEAEDEDLSDSDGDGSEPSEKRTRLEEEIVERNRKRRQRREWE
ARRKDILFDYEQYEYYGTSSAMVMFDLAWMMSKDLNDMLWWAIVGLTDQWVHDKITQMKY
VTDVGILQRHVSRHNHRNEAEENMLSVDCTRISFEYDLCLVLYQHWSLHESLYNTSYTAA
RFKLWSVHGQKRLQEFLADMGLPLKQVKQKFQSMDVSLKGNLREMIEESANKFGMKDMRV
QTFSIQFGFKHKFLASDVVFATMSLMESPEKDGSGTDHFIQALDSLSRSNLDKLYLGLEL
AKKHLQATQQTIASCLCTNLVTSQGPFLYCSLMEGTPDVTLFSKPASLSLLSRHLLKSFV
YSTKNRRCKLLPLVMAAPLSVEQGTVTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRTL
HNYFDLSVIELKAEDRSKFLDALVSLLS

CDC45

CDC45
PFAM accession number:PF02724
Interpro abstract (IPR003874): CDC45 is an essential gene required for initiation of DNA replication in Saccharomyces cerevisiae (cell division control protein 45), forming a complex with MCM5/CDC46. Homologs of CDC45 have been identified in human [(PUBMED:9660782)], mouse and the smut fungus, Melampsora spp., (tsd2 protein) among others.
GO process:DNA replication initiation (GO:0006270)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CDC45