The domain within your query sequence starts at position 50 and ends at position 325; the E-value for the CDC50 domain shown below is 3.4e-92.

VLPTFFIIGLIFIPIGIGIFVTSNNIREIEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNG
DPSALLNPSKECEPYRRNEDRPIAPCGAIANSMFNDTLELYLVANESDPKPIPIPLKKKG
IAWWTDKNVKFRNPPGKESLEEKFKDTIKPVNWHKAVYELDPEDESNNGFINEDFIVWMR
TAALPTFRKLYRLIERRDDLHPTLPAGQYFLNITYNYPVHSFDGRKRMILSTISWMGGKN
PFLGIAYITIGSISFLLGVVLLVINHKYRNSSNTAD

CDC50

CDC50
PFAM accession number:PF03381
Interpro abstract (IPR005045): CDC50/LEM3 is a family of membrane proteins whose members include cell cycle control protein 50, alkylphosphocholine resistance protein LEM3, which is is required for phospholipid translocation across the plasma membrane in Saccharomyces cerevisiae [(PUBMED:12133835)], and several ALA-interacting subunits, which are plant proteins involved in lipid translocation and secretory vesicle formation [(PUBMED:18344284)].
GO component:membrane (GO:0016020)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CDC50