The domain within your query sequence starts at position 356 and ends at position 521; the E-value for the CDC73_C domain shown below is 2.6e-53.

GSRTPIIIIPAATTSLITMLNAKDLLQDLKFVPSDEKKKQGCQRENETLIQRRKDQMQPG
GTAISVTVPYRVVDQPLKLMPQDWDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKA
FHLKYDEVRLDPNVQKWDVTVLELSYHKRHLDRPVFLRFWETLDRY

CDC73_C

CDC73_C
PFAM accession number:PF05179
Interpro abstract (IPR031336):

CDC73 is an RNA polymerase II accessory factor [(PUBMED:8812838)], and forms part of the Paf1 complex that has roles in post-initiation events [(PUBMED:9032243)]. More specifically, crystal structure analysis shows the C terminus to be a Ras-like domain that adopts a fold that is highly similar to GTPases of the Ras superfamily. The canonical nucleotide binding pocket is altered in CDC73, and there is no nucleotide ligand, but it contributes to histone methylation and Paf1 complex (Paf1C) recruitment to active genes. Thus, together with Rtf1, it combines to couple Paf1C to elongating polymerase [(PUBMED:9891041)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CDC73_C