The domain within your query sequence starts at position 1 and ends at position 297; the E-value for the CDC73_N domain shown below is 3.4e-135.

MADVLSVLRQYNIQKKEIVVKGDEVIFGEFSWPKNVKTNYVVWGTGKEGQPREYYTLDSI
LFLLNNVHLSHPVYVRRAATENIPVVRRPDRKDLLGYLNGEASTSASIDRSAPLEIGLQR
STQVKRAADEVLAEAKKPRIEDEECVRLDKERLAARLEGHKEGIVQTEQIRSLSEAMSVE
KIAAIKAKIMAKKRSTIKTDLDDDITALKQRSFVDAEVDVTRDIVSRERVWRTRTTILQS
TGKNFSKNIFAILQSVKAREEGRAPEQRPAPNAAPVDPTLRTKQPIPAAYNRYDQER

CDC73_N

CDC73_N
PFAM accession number:PF16050
Interpro abstract (IPR032041):

This is the N-terminal region of Cdc73 (cell division cycle 73). Cdc73 forms part of the Paf1 post-initiation complex [(PUBMED:9891041)]. As part of the Paf1 complex, Cdc73 associates with RNA-polymerase II and is involved in several transcriptional and posttranscriptional events. In vertebrates, the protein encoded by HRPT2/CCdc73 is known as Parafibromin, and acts as a tumour suppressor [(PUBMED:15580289), (PUBMED:16989776)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CDC73_N