The domain within your query sequence starts at position 34 and ends at position 84; the E-value for the CDI domain shown below is 1.6e-16.

SLFGPVDHEELGRELRMRLAELNAEDQNRWDFNFQQDVPLRGPGRLQWMEV

CDI

CDI
PFAM accession number:PF02234
Interpro abstract (IPR003175):

Cell cycle progression is negatively controlled by cyclin-dependent kinases inhibitors (CDIs). CDIs are involved in cell cycle arrest at the G1 phase.

GO process:cell cycle arrest (GO:0007050)
GO component:nucleus (GO:0005634)
GO function:cyclin-dependent protein serine/threonine kinase inhibitor activity (GO:0004861)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CDI