The domain within your query sequence starts at position 1 and ends at position 170; the E-value for the CDO_I domain shown below is 3e-81.

MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTR
NLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKK
SERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQR

CDO_I

• PFAM accession number: PF05995
• Interpro abstract (IPR010300):

  Cysteine dioxygenase (CDO) plays an important role in the homeostatic regulation of steady-state cysteine levels and provides important oxidized metabolites of cysteine such as sulfate and taurine. It converts cysteine to cysteinesulphinic acid and is the rate-limiting step in sulphate production [ (PUBMED:16855246) ].

  This entry also includes a cysteine dioxygenase homologue from Pseudomonas aeruginosa known as p3MDO. It functions as a 3-mercaptopropionate dioxygenase that catalyses the dioxygenation of 3-MPA to 3-sulfinopropionic acid (3-SPA) [ (PUBMED:26272617) ]. 3-Mercaptopropionic acid (3-MPA) is a structural analogue of cysteine.

• GO process: oxidation-reduction process (GO:0055114)
• GO function: iron ion binding (GO:0005506), oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen (GO:0016702)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CDO_I