The domain within your query sequence starts at position 1 and ends at position 170; the E-value for the CDO_I domain shown below is 3e-81.

MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTR
NLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKK
SERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQR

CDO_I

CDO_I
PFAM accession number:PF05995
Interpro abstract (IPR010300):

Cysteine dioxygenase (CDO) plays an important role in the homeostatic regulation of steady-state cysteine levels and provides important oxidized metabolites of cysteine such as sulfate and taurine. It converts cysteine to cysteinesulphinic acid and is the rate-limiting step in sulphate production [(PUBMED:16855246)].

This entry also includes a cysteine dioxygenase homologue from Pseudomonas aeruginosa known as p3MDO. It functions as a 3-mercaptopropionate dioxygenase that catalyses the dioxygenation of 3-MPA to 3-sulfinopropionic acid (3-SPA) [(PUBMED:26272617)]. 3-Mercaptopropionic acid (3-MPA) is a structural analogue of cysteine.

GO process:oxidation-reduction process (GO:0055114)
GO function:iron ion binding (GO:0005506), oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen (GO:0016702)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CDO_I