The domain within your query sequence starts at position 83 and ends at position 158; the E-value for the CDP-OH_P_transf domain shown below is 7.4e-18.

IAPNLITIIGLSINICTTILLVFYCPTATEQAPLWAYIACACGLFIYQSLDAIDGKQARR
TNSSSPLGELFDHGCD

CDP-OH_P_transf

CDP-OH_P_transf
PFAM accession number:PF01066
Interpro abstract (IPR000462): A number of phosphatidyltransferases, which are all involved in phospholipid biosynthesis and that share the property of catalyzing the displacement of CMP from a CDP-alcohol by a second alcohol with formation of a phosphodiester bond and concomitant breaking of a phosphoride anhydride bond share a conserved sequence region [(PUBMED:3031032), (PUBMED:1848238)]. These enzymes are proteins of 200 to 400 amino acid residues. The conserved region contains three aspartic acid residues and is located in the N-terminal section of the sequences.
GO process:phospholipid biosynthetic process (GO:0008654)
GO component:membrane (GO:0016020)
GO function:phosphotransferase activity, for other substituted phosphate groups (GO:0016780)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CDP-OH_P_transf