The domain within your query sequence starts at position 1 and ends at position 104; the E-value for the CDV3 domain shown below is 2.9e-55.

MQISEKEDDDNEKREDPGDNWEEGGGGSGAEKSSGPWNKTAPVQAPPAPVTVTETPEPAM
PSGVYRPPGARLTTTRKTPQGPPEIYSDTQFPSLQSTAKHVESR

CDV3

CDV3
PFAM accession number:PF15359
Interpro abstract (IPR026806):

Protein CDV3 (carnitine deficiency-associated protein 3) is up-regulated in ventricles of juvenile visceral steatosis mice [(PUBMED:12359334)]. Another study showed that CDV3 is phosphorylated by Abl, a tyrosine kinase involved in normal B cell development [(PUBMED:12606058)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CDV3