The domain within your query sequence starts at position 1 and ends at position 149; the E-value for the CEND1 domain shown below is 1.3e-72.

MESRGKSASSPKPDTKVPQATAEAKATPAADGKAPLTKPVKKDTQAEKQEQAAAPGPAAT
KKTPAKADPVLLNNHSNLKPAPTVPAAPSSPDATSEPKGPGDGAEEDESNTGGRGPWPCE
NLTPLLVAGGVAVATIALILGVAFLARKK

CEND1

 CEND1
PFAM accession number:PF15677
Interpro abstract (IPR020162):

Cell cycle exit and neuronal differentiation protein 1 (Cend1 or BM88) is a homodimer of 140 amino acids. It has a putative transmembrane domain at the C terminus. The mRNA of this protein is expressed only in neural tissues, where it is restricted to neurons. It is involved in neuroblastoma cell differentiation [ (PUBMED:7775480) (PUBMED:24312406) ], neuronal differentiation [ (PUBMED:23658157) ], and development of the cerebellum [ (PUBMED:20153830) ].

GO process:neuron differentiation (GO:0030182), cerebellum development (GO:0021549)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CEND1