The domain within your query sequence starts at position 499 and ends at position 598; the E-value for the CENP-B_dimeris domain shown below is 5.8e-64.

PTLHFLEGGEDSDSDSDEEEDDEEEDEEDEDEEDDEDGDEVPVPSFGEAMAYFAMVKRYL
TSFPIDDRVQSHILHLEHDLVHVTRKNHARQAGVRGLGHQ

CENP-B_dimeris

CENP-B_dimeris
PFAM accession number:PF09026
Interpro abstract (IPR015115):

Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box. CENP-B may organise arrays of centromere satellite DNA into a higher order structure, which then directs centromere formation and kinetochore assembly in mammalian chromosomes.

The CENP-B dimerisation domain is composed of two alpha-helices, which are folded into an antiparallel configuration. Dimerisation of CENP-B is mediated by this domain, in which monomers dimerise to form a symmetrical, antiparallel, four-helix bundle structure with a large hydrophobic patch in which 23 residues of one monomer form van der Waals contacts with the other monomer. This CENP-B dimer configuration may be suitable for capturing two distant CENP-B boxes during centromeric heterochromatin formation [(PUBMED:14522975)].

This C-terminal domain contains the dimerization domain that has being delimited to the C-terminal 59 amino acid residues of CENP-B [(PUBMED:7862152)].
GO component:nucleus (GO:0005634), chromosome, centromeric region (GO:0000775)
GO function:DNA binding (GO:0003677), chromatin binding (GO:0003682)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-B_dimeris