SMART: Pfam domain CENP-C

The domain within your query sequence starts at position 819 and ends at position 903; the E-value for the CENP-C_C domain shown below is 3.9e-28.

LKVFKTLDTIYFSTGKLVLGPYEEKGKQHVGQDILVFYVNFGDLLCTLHETPYKLTTGDS
FYVPSGNHYNIKNLLNVESSLLFTQ

CENP-C_C

PFAM accession number:	PF11699
Interpro abstract (IPR025974):	This entry represents a C-terminal domain found in Mif2 and CENP-C. CENP-C is the inner-kinetochore centromere (CEN) binding protein. In the budding-yeast, Mif2, the yeast homologue, binds in the CDEIII region of the centromere, and has been shown to recruit a substantial subset of all inner and outer kinetochore proteins [ (PUBMED:18701705) ]. Mif2 adopts a cupin fold and is extremely similar both in polypeptide chain conformation and in dimer geometry to the dimerisation domain of a bacterial transcription factor [ (PUBMED:18701705) ]. The Mif2 dimer appears to be part of an enhanceosome-like structure that nucleates kinetochore assembly in budding yeast [ (PUBMED:18701705) ]. This C-terminal domain is the region via which CENP-C localises to centromeres throughout the cell cycle [ (PUBMED:19503796) (PUBMED:21353555) ].

PFAM accession number:

PF11699

Interpro abstract (IPR025974):

This entry represents a C-terminal domain found in Mif2 and CENP-C.

CENP-C is the inner-kinetochore centromere (CEN) binding protein. In the budding-yeast, Mif2, the yeast homologue, binds in the CDEIII region of the centromere, and has been shown to recruit a substantial subset of all inner and outer kinetochore proteins [ (PUBMED:18701705) ]. Mif2 adopts a cupin fold and is extremely similar both in polypeptide chain conformation and in dimer geometry to the dimerisation domain of a bacterial transcription factor [ (PUBMED:18701705) ]. The Mif2 dimer appears to be part of an enhanceosome-like structure that nucleates kinetochore assembly in budding yeast [ (PUBMED:18701705) ]. This C-terminal domain is the region via which CENP-C localises to centromeres throughout the cell cycle [ (PUBMED:19503796) (PUBMED:21353555) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-C_C