The domain within your query sequence starts at position 1 and ends at position 65; the E-value for the CENP-F_N domain shown below is 8.7e-35.

MSWALEEWKEGLPSRALQKIQELEGQLEKLKKEKQQRQFQLDSLEAALQKQKQKVSVWQA
ADCWL

CENP-F_N

CENP-F_N
PFAM accession number:PF10481
Interpro abstract (IPR018463):

Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [(PUBMED:15939891)]. Most of the kinetochore/centromere functions appear to depend upon binding of the C-terminal part of the molecule, whereas the N-terminal part, here, may be a cytoplasmic player in controlling the function of microtubules and dynein [(PUBMED:9704407)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-F_N