The domain within your query sequence starts at position 1 and ends at position 231; the E-value for the CENP-K domain shown below is 1.1e-99.

MSENKQEVHPDTITDVEAVIDTEEELIKECEEMWKDMEDCQNKLSLIGTETLTNADAQLS
LLIMQMKCLTAELGQWKKRKPEIIPLNEDVLLTLGKEEFQKLRCDLEMVLSTIQSKNEKL
KEDLEREQQWLDEQQQILDTLNVLNSDVENQVVTLTESRIFNELTTKIRGIKEFKEKLLL
TLGAFLDNHFPLPEASTPKKRKNIQDSNAQLITLNEILEVPLRAMGSTLES

CENP-K

• PFAM accession number: PF11802
• Interpro abstract (IPR020993):

  Cenp-K is one of seven new Cenp-A-nucleosome distal (CAD) centromere components (the others being Cenp-L, Cenp-O, Cenp-P, Cenp-Q, Cenp-R and Cenp-S) that are identified as assembling on the Cenp-A nucleosome associated complex, NAC [ (PUBMED:16622419) ]. The Cenp-A NAC is essential, as disruption of the complex causes errors of chromosome alignment and segregation that preclude cell survival despite continued centromere-derived mitotic checkpoint signalling. Cenp-K is centromere-associated through its interaction with one or more components of the Cenp-A NAC. It may be involved in incorporation of newly synthesized Cenp-A into centromeres via its interaction with the Cenp-A-NAC complex [ (PUBMED:18045986) ].

  The homologue in Schizosaccharomyces pombe is known as inner kinetochore subunit sim4 [ (PUBMED:12719471) (PUBMED:18007590) ].

• GO process: kinetochore assembly (GO:0051382)
• GO component: nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-K